Главная | Случайная
Обратная связь

ТОР 5 статей:

Методические подходы к анализу финансового состояния предприятия

Проблема периодизации русской литературы ХХ века. Краткая характеристика второй половины ХХ века

Ценовые и неценовые факторы

Характеристика шлифовальных кругов и ее маркировка

Служебные части речи. Предлог. Союз. Частицы

КАТЕГОРИИ:






Ситуационные задачи по теме с эталонами ответов. По электронной почте Вам пришло сообщение, с прикрепленной к нему картинкой:




Задача №1

По электронной почте Вам пришло сообщение, с прикрепленной к нему картинкой:

1. Содержит ли для Вас данное сообщение информацию? Для кого данное сообщение может содержать какую любо информацию? Почему?

2. Что понимают под термином «информация» применительно к компьютерной обработке данных?

Ответ к задаче № 1

1. Одно и то же информационное сообщение (статья в газете, объявление, письмо, телеграмма, справка, рассказ, чертёж, радиопередача и т.п.) может содержать разное количество информации для разных людей — в зависимости от их предшествующих знаний, от уровня понимания этого сообщения и интереса к нему.

Так как сообщение составлено на японском языке, то для Вас оно не несёт никакой информации как для человека, не знающего этого языка. Но это же сообщение может быть высокоинформативным для человека, владеющего японским.

2. Применительно к компьютерной обработке данных под «информацией» понимают некоторую последовательность символических обозначений (букв, цифр, закодированных графических образов и звуков и т.п.), несущую смысловую нагрузку и представленную в понятном компьютеру виде. Каждый новый символ в такой последовательности символов увеличивает информационный объём сообщения.

Задача №2

Вы получили новый компьютер со склада. Компьютер предназначен для работы с больничной документацией (электронного документооборота в больнице нет) и для доступа в Интернет.

1. Какой минимальный набор программ вы установите?

2. Приведите примеры программ, которые распространяются бесплатно или условно бесплатно (свободное программное обеспечение).

Ответ к задаче №2

1. Операционная система, драйверы на устройства компьютера, офисный пакет, интернет-браузер (идет в комплекте с операционной системой), антивирусная программа, программа-архиватор

2. Операционная система (Linux), офисный пакет (Open Office), интернет-браузер (Mozilla, Chrome, Safari, IE, Opera), антивирусная программа (Avast, AVG), программа-архиватор (7-Zip, IZArc, TUGZip).

Задача №3

Интернет, на сегодняшний день, представляет собой огромное скопление разнообразной информации, значительная часть которой является не достоверной.

1. Расскажите, какие сайты в Интернете содержат достоверную медицинскую информацию?

2. Почему этим сайтам можно доверять?

3. Найдите в Интернете не менее 6-ти профессиональных медицинских новостей за последний месяц.

Ответ к задаче №3

1. Среди сайтов, предоставляющих доступ к базам данных, безусловным лидером является всем известный PubMed MEDLINE (http://www.ncbi.nlm.nih.gov/entrez/query.fcgi?db=PubMed. На сайте Medscape (http://www.medscape.com/) представлено большое количество журналов, доступ к которым предоставляется бесплатно после заполнения регистрационной формы. Портал Medbioworld (http://www.medbioworld.com/) является одной из наиболее полных коллекций ссылок на источники профессиональной медицинской информации в сети Интернет. Данный ресурс содержит более 25000 ссылок на медицинские журналы, профессиональные медицинские ассоциации, медицинские словари, нозологические базы данных, клинические испытания, руководства.

2. Им можно доверять, так как они являются специализированными порталами, предоставляющими профессиональную медицинскую информацию, которым доверяет весь мир.

3. Для поиска профессиональных медицинских новостей можно воспользоваться порталом Medbioworld (http://www.medbioworld.com/). На главной странице представлена ссылка на профессиональные медицинские новости. . Зайти по ссылке и ознакомиться с последними новостями текущего месяца.

News. Professional Medical NewsProfessional Medical News. Health eLineHealth eLine. 2011-01-07.

· Moxifloxacin beats clindamycin for some odontogenic infections.

· Newer antipsychotics overused, U.S. study suggests.

· First-in-class antibiotic has high risk of adverse events and death.

Задача №4

Вы составили научный литературный обзор 1 год назад. Теперь Вам нужно его актуализировать.

1. Каковы Ваши действия?

2. Какие основные функции расширенного поиска Вы знаете?

Ответ к задаче №4

1. Необходимо взять разработанную формулу запроса и провести поиск за последние два года. Такая глубина необходима, поскольку запаздывающие журналы (русские, китайские), могут быть индексированы в MEDLINE с большим опозданием.

2. По местам поиска: по автору, изданию, дате публикации, теме исследования, заголовку, языку публикации, рубрике в БД и др. Логические операторы: AND, OR, NOT

Задача №5

Вы – староста группы первокурсников. Куратор группы, попросил вас помочь подготовить документ, в котором будет отражаться успеваемость студентов в сессию.

1. Укажите, какую программу пакета Office проще всего использовать в этом случае.

2. Используя соответствующий программный продукт, выполните задание. Составьте таблицу, содержащую следующие данные: ФИО студента и наличие у него определенных зачетов (или отработок). В группе 10 студентов, и в первом семестре каждому необходимо сдать 13 зачетов.

Ответ к задаче №5

1. MS Word

2. Выполненная задача должна выглядеть примерно следующим образом:

Группа 108, Лечебное дело

N Ф.И.О. Анатомия Математика Физика Культурология Биоэтика Основные типы химического равновесия Общая химия Иностранный язык (немецкий) Информатика Информационные технологии
Азизов Аловаддин Хакимджонович     зачет Отр. зачет          
Асанова Жаныл Ажибайевна     зачет Отр. зачет     зачет зачет зачет
Болсуновская Екатерина Дмитриевна   зачет зачет Отр. зачет     зачет зачет зачет
Вайгандт Любовь Николаевна   зачет зачет Отр. зачет Отр. зачет зачет зачет зачет

Задача №6

Вы всей семьей подключились к новому тарифному плану, в котором минута разговора стоит 3 условные единицы.

1. Заполните данную таблицу необходимыми формулами и рассчитайте, какую сумму, в рублях, потратил каждый из членов семьи на телефонные разговоры

2. Постройте гистограмму «Ежемесячные затраты членов семьи на разговоры»

  1 неделя 2 неделя 3 неделя 4 неделя Кол-во мин. за мес. Сумма в у.е. Сумма в руб.
Мама      
Папа      
Сестра      
Брат      
          Общее кол-во минут:    

Ответ к задаче №6

1.

1) Вставьте таблицу в новый лист Microsoft Excel, начиная с ячейки A2;

2) Сделайте заголовок в ячейках A1:F1 c надписью «Телефоны»;

3) Введите в ячейку J2 текст «Курс доллара», отформатированный следующим образом: Шрифт Arial Black, размер 14, темно-зеленого цвета;

4) В ячейку J3 введите значение «29,3», выберите оранжевый цвет для шрифта;

5) В ячейку F2 введите формулу: =СУММ(B3:E3), скопируйте ее в диапазон (F4:F6);

6) В ячейку G2 введите формулу: =0,03*F3, скопируйте ее в диапазон (G4:G6);

7) В ячейку G7 введите формулу: =СУММ(G3:G6);

8) В ячейку H3 введите формулу =G3*$J$3, скопируйте ее в диапазон (H4:H6);

9) В ячейку H7 введите формулу: =СУММ(H3:H6).

2.

1) Вставьте гистограмму на Листе 2, для чего выделите диапазон A3:A6 и, держа клавишу Ctrl, диапазон (H3:H6). Затем вызываем мастер диаграмм с панели инструментов и строим гистограмму, в которой по оси Y – сумма в рублях, на оси Х – члены семьи;

2) Сохраните файл как «ФИО_номер группы.xls».

Задача №7

Вам необходимо обработать результаты опроса пациентов Центра здоровья. Были получены данные, содержащие информацию о поле, возрасте (возраст 20-40 лет), массе тела (кг), росте (см). Создайте базу данных, содержащую 20 записей, и выполните следующее задание:

1. Вставьте после поля рост столбец ИМТ и рассчитайте индекс массы тела по формуле: ИМТ = масса тела (кг)/рост (м)2

2. С помощью автофильтра выберите мужчин и женщин возрасте от 25 до 35 лет и рассчитайте средние значения ИМТ с помощью функции =ПРОМЕЖУТОЧНЫЕ ИТОГИ

3. Сделайте на листе 2 таблицу по образцу и вставьте в нее полученные результаты

Пол Средние значения ИМТ
Муж  
Жен  

Ответ к задаче №7

1.

1. Формируем список пациентов, для чего в ячейку А1 вводим текст № записи, в ячейку В2 – пол (1- мужской; 2 - женский) и так далее до ячейки F1 - ИМТ.

2. Заполняем список данными, соответствующими реальным пропорциям человеческого тела соответствующего возраста и пола.

3. Вводим в ячейку F2 формулу: =D2/(E2/100)^2

4. Копируем формулу в остальные ячейки диапазона, протянув мышью черный квадратик в правом нижнем углу, как показано на рисунке:

 

1. С помощью мастера функций вставьте в ячейку F21 функцию =ПРОМЕЖУТОЧНЫЕ.ИТОГИ

2.

2. С помощью автофильтра в меню «Данные», « Автофильтр» отберите записи соответствующие условию мужчины в возрасте 25-35 лет.

3. Полученные в ячейке F21 значения скопировать в таблицу на листе 2.

4. Для этого поместите курсор на данную ячейку, нажмите правую кнопку мыши и выберите в появившемся контекстном меню копировать.

3.

5. Затем перейдите в таблицу на листе 2 и поставьте курсор мыши в ячейку средние значения ИМТ мужчины, нажмите правую кнопку мыши в выберите в появившемся контекстном меню специальная вставка, в открывшемся меню выберите значения.

6. Действия в п. 6-9 повторите для женщин.

7. Сохраните файл под именем ФИО_номер группы.xls

Задача №8

Представлена база данных пациентов:

Фамилия пациента Имя пациента Отчество пациента Год рождения
Чернов Александр Андреевич
Петров Иван Кириллович
Черкашин Антон Анатольевич
Чернов Александр Андреевич

В записях базы данных присутствуют однофамильцы.

1. Какое(ие) поле(я) нужно добавить к структуре базы данных для уникальной идентификации пациентов?

2. Какому типу данных будет соответствовать это(и) поле(я)?

Ответ к задаче №8

1. В медицинской базе данных подобным полем может быть поле «Номер истории болезни» или «ID» (идентификационный номер).

2. Полю «Номер истории болезни» будет соответствовать числовой тип данных (длинное целое). Для уникальной идентификации записей полю необходимо назначить свойство «Ключевое».

Задача№9

Вы работаете хирургом уже 5 лет, и на протяжении этого времени Вы ведете электронную базу данных о проведенных Вами операциях, исходах этих операций. Вас попросили предоставить статистические данные о проделанной Вами работе за 5 лет.

1. Каким объектом баз данных можно воспользоваться?

2. Поясните, можно ли в этом случае использовать MS Word?

Ответ к задаче №9

1. Поскольку вся информация о деятельности врача хранится в базе данных, достаточно создать отчет, который бы включал в себя данные о количестве операций, проведенных врачом за это время, положительных исходах и отрицательных, а также о причинах.

2. Можно экспортировать отчет в MS Word в формат rtf, который позволяет вносить дополнительные коррективы в документ.

Задача №10

Миоглобин - кислород-связывающий белок скелетных мышц и мышцы сердца. Аминокислотная последовательность данного белка известна для многих организмов. Используя базу данных Uniprot.org, выясните:

1. Аминокислотную последовательность миоглобиона человека?

2. На сколько отличаются аминокислотные последовательности миоглобиона человека и другого млекопитающего (например, дельфина)?

Ответ к задаче №10

1. Необходимо осуществить поиск по базе данных Uniprot.org, запрос «myoglobin», из полученных результатов выбрать миоглобин человека и извлечь структуру последовательности (кнопка «Retrieve»). Последовательность в формате fasta:

>sp|P02144|MYG_HUMAN Myoglobin OS=Homo sapiens GN=MB PE=1 SV=2

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE

DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH

PGDFGADAQGAMNKALELFRKDMASNYKELGFQG

2. Необходимо к выбранному миоглобину человека добавить миоглобин другого млекопитающего (например, дельфина) и произвести выравнивание (кнопка «Align»). В результате будет получено выравнивание и дополнительные сведения.

 

Задача №11

Вы – сотрудник медицинского учреждения, использующего комплексную медицинскую информационную систему. Вам необходимо получить письменное согласие пациента на обработку его персональных данных. Пациент высказывает опасения по поводу безопасности хранения медицинской информации о нем в электронном виде.

1. Какими аргументами Вы можете убедить пациента, что хранить информацию о пациенте в электронном виде безопаснее, чем в бумажном?

2. Опишите, какие механизмы защиты персональных медицинских данных о пациенте реализованы в МИС?







Не нашли, что искали? Воспользуйтесь поиском:

vikidalka.ru - 2015-2020 год. Все права принадлежат их авторам! Нарушение авторских прав | Нарушение персональных данных