Главная | Случайная
Обратная связь

ТОР 5 статей:

Методические подходы к анализу финансового состояния предприятия

Проблема периодизации русской литературы ХХ века. Краткая характеристика второй половины ХХ века

Ценовые и неценовые факторы

Характеристика шлифовальных кругов и ее маркировка

Служебные части речи. Предлог. Союз. Частицы

КАТЕГОРИИ:






Rat CVS (Cardiovascular System)




Программа Rat CVS моделирует эксперимент по воздействию различных препаратов на сердечно-сосудистую систему крысы. Программа позволяет регистрировать изменения системного артериального давления, давления, создаваемого в левом желудочке, венозного давления, силу и частоту сердечного сокращения. Возможно также моделирование спинальной крысы. Экспериментатору возможно производить инъекции различных препаратов в требуемых дозах (дигоксин, атенолол, изопреналин, лозартан и т.д.), стимулировать нервную систему (блуждающий нерв и т.д.). Все это сопровождается визуализацией изменения параметров сердечно-сосудистой системы в реальном времени.

Программа может быть использована как для обучения студентов, так и для контроля – можно “вводить” крысе неизвестные препараты с целью их определения студентом. Rat CVS разработана John Dempster, University of Strathclyde.

Rat CVS - введение адреналина в дозе 10 мкг/кг

TheVirtualCat

Программа The Virual Cat моделирует эксперимент по воздействию различных препаратов на сердечно-сосудистую и мышечную систему кошки. Программа позволяет регистрировать изменения системного артериального давления, частоту сердечных сокращений, силу и частоту сокращений m. tibialis. Экспериментатор может вводить широкий спектр препаратов (атропин, гистамин, морфин, тубокурарин) в необходимой дозе. Так же, как и Rat CVS, программа Virtual Cat может быть использована и для обучения и для контроля – возможен режим работы, при котором студенту необходимо определить “введенный” в кровоток или прямо в мышцу препарат. The Virtual Cat разработана John Dempster, University of Strathclyde.

The Virtual Cat - введение ацетилхолина в дозе 5 мкг/кг

- симуляторы с использованием манекенов могут быть выполнены с различной степенью сложности и реалистичности, но обычно всегда дороги. Передовые модели включают физическую модель человеческого тела и непрерывно регистрируют сигналы, отражающие физиологические параметры, такие как электрокардиограмма, артериальное давление, капнограмма, пульсоксиметрия и т.д. Ранние системы такого рода требовали вмешательства обучаемого для изменения поведения в соответствии с предпринимаемыми действиями. Современные варианты используют сложные компьютерные модели физиологии и фармакологии человека для автоматической генерации ответов манекеном и сигнальными отведениями. В противоположность текстовому и графическому тренажерам, использование манекенов позволяет развить некоторые практические навыки, которые впоследствии будут применяться в клинике.

- симуляторы виртуальной реальности начали приобретать популярность последнее время, особенно для обучения хирургов. С их помощью возможен переход от двумерного руководства к миру трехмерных имитированных больных. Принципиальная сложность существует в трудности моделирования тактильных ощущений. Тем не менне эта проблема активно разрабатывается в многочисленных научно-исследовательских центрах с привлечением микро-технологий.

Виртуальное вскрытие в виртуальной лаборатории

Вопросы по теме занятия

1. Что такое компьютерная модель?

2. Опишите схему рационального исследования с применением результатов исследований in vivo и in vitro.

3. Перечислите основные этапы компьютерного моделирования.

4. Назовите примеры задач компьютерного моделирования физиологических процессов (минимум 5).

5. В чем сложность моделирования морфологических процессов?

6. Перечислите науки, которые используют компьютерные методы в моделировании молекулярно-генетических и биохимических процессов.

7. Перечислите задачи, решаемые системами поддержки принятия решения в медицине.

8. В чем преимущества и недостатки использования компьютерных методов в медицинском образовании?

9. Назовите категории компьютерных моделей, применяемых в медицинском образовании.

10. Перечислите известные вам банки молекулярно-генетических данных (минимум 3).

9. Тестовые задания по теме с эталонами ответов.

1. ЭКСПЕРТНАЯ СИСТЕМА – ЭТО...

1) система, которая в будущем полностью заменит врачей;

2) система управления базами данных;

3) компьютерная программа, способная частично заменить специалиста-эксперта в разрешении проблемной ситуации;

4) компьютерная программа, в которой работают только эксперты;

5) система, предоставляющиая возможность создать 3D модель объекта.

2. КОМПЬЮТЕРНЫЕ МЕТОДЫ В МЕДИЦИНСКОМ ОБРАЗОВАНИИ:

1) позволяют полностью исключить эксперименты с лабораторными животными;

2) способствуют пониманию и усвоению материала на теоретическом уровне, но не развивают у студентов практических навыков;

3) дают возможность получения полноценного медицинского образования в дистанционной форме;

4) позволяют полностью отказаться от клинических испытаний на животных;

5) полностью заменить преподавателя на занятии.

3. К ОСНОВНЫМ ЭТАПАМ КОМПЬЮТЕРНОГО МОДЕЛИРОВАНИЯ ОТНОСЯТСЯ:

А - постановка задачи;

Б - переход к математической модели;

В - проведение клинических испытаний;

Г - анализ и интерпретация результатов.

1) а, б, в;

2) б, в, г;

3) а, в, г;

4) а, б, г;

5) б, в.

4. ПРАВИЛЬНОЙ ПОСЛЕДОВАТЕЛЬНОСТЬЮ ЭТАПОВ КОМПЬЮТЕРНОГО МОДЕЛИРОВАНИ ЯВЛЯЕТСЯ:

А - концептуальная модель;

Б - анализ и интерпретация результатов;

В - постановка задачи;

Г - формализация, алгоритм;

Д - компьютерный эксперимент.

1) А, Б, В, Г, Д;

2) В, А, Д, Г, Б;

3) В, А, Г, Д ,Б;

4) В, Д, Г, А, Б;

5) А, Г, Д, Б, В.

5. КОМПЬЮТЕРНОЕ МОДЕЛИРОВАНИЕ МОРФОЛОГИЧЕСКИХ ПРОЦЕССОВ НА ДАННЫЙ МОМЕНТ…

1) позволяет смоделировать развитие человеческого организма от стадии оплодотворенной яйцеклетки до взрослой особи на молекулярно-генетическом уровне;

2) позволяет воссоздать эволюционный процесс на Земле;

3) позволяет создавать модели только некоторых морфологических и морфогенетических процессов

4) является устаревшим направлением;

5) позволяет проводить различные эксперименты по создаию новых видов животных.

 

Эталоны ответов:

№ вопроса
Правильный ответ

10. Ситуационные задачи по теме с эталонами ответов.

Задача №1

Известно, что всего одна аминокислотная замена в бета-цепи гемоглобина человека приводит к заболеванию серповидноклеточной анемией. Используя программу StarBioChem, выясните:

1. Замена какого аминокислотного остатка приводит к патологии?

2. Какова структура (конформация) белка в норме и при патологии? (ответ дать в виде графических изображений, выделить гемы)

Ответ к задаче №1

1. В программе StarBioChem можно посмотреть аминокислотную структуру белка: бета-цепь глобина человека в норме на 6 позиции содержит глутаминовую кислоту, а при указанной патологии – валин.

2. Гемоглобин в норме

Гемоглобин при указанной патологии

Задача №2

Миоглобин - кислород-связывающий белок скелетных мышц и мышцы сердца. Аминокислотная последовательность данного белка известна для многих организмов. Используя базу данных Uniprot.org, выясните:

1. Аминокислотную последовательность миоглобиона человека?

2. На сколько отличаются аминокислотные последовательности миоглобиона человека и другого млекопитающего (например, дельфина)?

Ответ к задаче №2

1. Необходимо осуществить поиск по базе данных Uniprot.org, запрос «myoglobin», из полученных результатов выбрать миоглобин человека и извлечь структуру последовательности (кнопка «Retrieve»). Последовательность в формате fasta:

>sp|P02144|MYG_HUMAN Myoglobin OS=Homo sapiens GN=MB PE=1 SV=2

MGLSDGEWQLVLNVWGKVEADIPGHGQEVLIRLFKGHPETLEKFDKFKHLKSEDEMKASE

DLKKHGATVLTALGGILKKKGHHEAEIKPLAQSHATKHKIPVKYLEFISECIIQVLQSKH

PGDFGADAQGAMNKALELFRKDMASNYKELGFQG

2. Необходимо к выбранному миоглобину человека добавить миоглобин другого млекопитающего (например, дельфина) и произвести выравнивание (кнопка «Align»). В результате будет получено выравнивание и дополнительные сведения.

 







Не нашли, что искали? Воспользуйтесь поиском:

vikidalka.ru - 2015-2020 год. Все права принадлежат их авторам! Нарушение авторских прав | Нарушение персональных данных